<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0983 0983b U.S. 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K20T, E35D, M36I, R41K, R57K, H69K, L89M, I93M  
>0983b| codons 4-99
TLWQRPVVTVKIGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       T39A, E44D, V60I, D121H, K122E, D123S, I142V, K173S, Q174K, D177E, V179I, T200A, Q207A, R211K  
>0983b| codons 38-247
CAEMEKDGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRSKNPEIIIYQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003