<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PO-Pt2 Orl2-W80 Italy 1996 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 AZT 80

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       V35T, I135V, S162C, E169D, K173I, Q174K, V179I, Q207E, R211K  
>Orl2-W80| codons 3-220
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPVFA
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRIKNPDIIIYQ
YMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKK

References
Author Title Citation
Orlandi, P Analysis of HIV-1 reverse transcriptase gene mutations in infected children treated with zidovudine. JAIDS, 1998