<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA39245 CA88620 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ATV+FTC+RTV+TDF 26
2 3TC+ABC+EFV 103

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V   Y188L V179D T7P, K20R, T69S, A98S, V106I, K122E, I135K, D177E, I178V, Q197E, Q207E, L210S, R211K, F214L, A272P, L283I, I293V  
>CA88620| codons 1-302
PISPIEPVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSITVLDVGDAFFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVDI
YQYVDDLLVGSDLEIGEHRTKIEELREHLSKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, N37E, L38LM, P39PS, L63P, A71AT, I72E, V77I, I93L  
>CA88619| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMEMSGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009