<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JIDP27 JIDP27W0 U.S. 1989 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83K, E138A, K166R, G196E, V241X W239C
>JIDP27W0| codons 26-245
LTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNATPGIRYQ
YNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRTKIEEL
RQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKCTXQPIV

References
Author Title Citation
Shafer, RW Combination therapy with zidovudine and didanosine selects for drug-resistant human immunodeficiency virus type 1 strains with unique patterns of pol gene mutations. J Infect Dis, 1994
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005