<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4812 CA88223 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 110
2 AZT+DDI 40
3 3TC+AZT 94
4 DLV+NFV+SQV 116
5 APV+D4T+DDI 17
6 D4T+DDI 14
7 3TC+DDI+IDV+NFV+RTV 9
8 3TC+APV+DDI+NFV+RTV 24
9 3TC+EFV+LPV 161
10 3TC+LPV+TDF 72
11 LPV+TDF 113

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10V, I13V, N37S, L63P, A71T, V77I  
>CA88223| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y K219E Y181C   E6D, K11KR, V35M, T39A, K43E, V111I, D123E, I142V, D177E, I178L, H208Y, R211K, L228H, A272P, K277R, T286A, I293V E40S
>CA88224| codons 1-300
PISPIDTVPVRLKPGMDGPKVKQWPLTEEKIKALMEICASLEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
CQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010