<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM13853 BREPM13853 Brazil 2000 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G17D, K20R, E35D, M36I, R41K, K43R, R57K, Q61N, I72R  
>BREPM13853| codons 1-99
PQITLWQRPLVTIKIGDQLREALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVKQYD
NILIEICGHKARGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, D121H, K122E, I135T, E169D, G196E, T200A, E204K, F214L, V245M, A272P, K281R, E297K, I329V, A376T, E399D, A400T, K431T, V435A, A446S, L452Q, V466A, D471E, T477A, H483Q, L491S, S519N, A534S, A554T, K558R, V559I  
>BREPM13853| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEKLRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKQGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSTGIRRIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, I72V, I84L, L101I, K111R, S119T, T124A, M154I, V165I, V201I, A205S, K211R, L234V, D256E S283G
>BREPM13853| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVRTIHTDNGTN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESINKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
de Sa Filho, DJ Identification of two HIV type 1 circulating recombinant forms in Brazil. ARHR, 2006