<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM11932 BREPM11932 Brazil 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  E138D, V151I E10D, A21S, M50I, I72V, I113V, T125A  
>BREPM11932| codons 1-288
FLDGIDKAQDEHEKYHSNWRSMASDFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTAVKAACWWAGIKQDFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, I15V, K20R, E35D, M36I, N37E, R57K, Q61N, L63T, H69Q, I72T  
>BREPM11932| codons 1-99
PQITLWQRPLVNIKVGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFIKVKQYD
NITIEICGQKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69~, K70R       S68G, I135T, R211K, V245M, A272P, Q278H, K281R, T286A, I293V, K311R, M357T, A376T, T386I, F416Y, V435A, F440Y, L452K, L491S, Q524E, A554T K220N
>BREPM11932| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDG~RWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKNHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCRLLRGAKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKITTESIVIWGKIPKFKLPIQKETWEAWWTEYWQATWIPEWEYVNTP
PLVKLWYQLEKEPIAGAETYYVDGAANRETKKGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
de Sa Filho, DJ Identification of two HIV type 1 circulating recombinant forms in Brazil. ARHR, 2006