<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM11931 BREPM11931 Brazil 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  E138D E10D, A21S, V31I, M50I, K71N, I72V, G106R, T125A, K156N N117H
>BREPM11931| codons 1-288
FLDGIDKAQDEHEKYHSNWRSMASDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGNVILVAVHVASGYIEAEVIPAETGQETAYFLLKLARRWPVKTIHTDHGSN
FTSTAVKAACWWAGIKQDFGIPYNPQSQGVVESMNNELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, I15V, K20R, E35D, M36I, N37E, R57K, Q61N, L63T, H69Q, I72T  
>BREPM11931| codons 1-99
PQITLWQRPLVNIKVGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFIKVKQYD
NITIEICGQKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
de Sa Filho, DJ Identification of two HIV type 1 circulating recombinant forms in Brazil. ARHR, 2006