<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM11884 BREPM11884 Brazil 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, L101I, M154I, H171Y, V201I, D256E S283G
>BREPM11884| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESINKELKKIIGQVRDQAEYLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, E35D, R57K, Q61N, L63F, E65D, I72T  
>BREPM11884| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
NIFIDICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, D123E, R211K, E248D, D250G, A272P, K281R, E297R, S322T, A376T, E396D, A400T, E449D, S468P, V496I, A554T  
>BREPM11884| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKGSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKDTWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRDTKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGLEVNIITDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
de Sa Filho, DJ Identification of two HIV type 1 circulating recombinant forms in Brazil. ARHR, 2006