<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UGA08483 99UGA08483 Uganda 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    M50L, I72V, L101I, T112I, I113V, T124A, T125A, I135V, F181L, V201I, Y227F, L234I, A265V  
>99UGA08483| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIVHTDNGSN
FTSAAVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYFRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, Q18H, N37S, R41K, I64V  
>99UGA08483| codons 1-99
PQITLWQRPLVTVKIGGHLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, K122E, D123G, I135V, E169D, D177E, I178M, I195R, G196E, T200I, Q207G, R211K, V245T, D250E, A272P, L282C, L283I, T286A, I293V, A327V, G335D, P345Q, F346H, R356K, A360T, T377Q, S379C, K390R, A400T, V458I, S468P, L469I, H483N, S519N, A534S, A554N, V559I G285R
>99UGA08483| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEMVI
YQYMDDLYVGSDLEREQHRIKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCIRRAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGQDQWTYQIYQEQHKNLKTGKYAKMRGT
HTNDVKQLTEAVQKIAQECIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYITDRGRQKVVPITDTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKIL

References
Author Title Citation
Kijak, GH Development and application of a high-throughput HIV type 1 genotyping assay to identify CRF02_AG in West/West Central Africa. ARHR, 2004