<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cu64 Cu64 Cuba 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, N37D, R41K, K43R, D60E, Q61E, L63P, H69Q  
>Cu64| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDIDLPGKWRPKMIGGIGGFIKVRQYE
EIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, D121H, K122E, E169D, D177E, Q207E, V245T, A272S, K277R, T286A, I293V, P313Q, I329V, G335D, R356K, M357L, T377Q, T403R, R461K, H483N, K530R, A554S  
>Cu64| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEQVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYAKLRGA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFKLPIQKETWEAWWREYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDKGRQKVVSLTDTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, D25E, V31I, T112V, S119P, T125A, V126M, G134N, I135V, K136Q, V201I, T206S, Q221S, L234I S283G
>Cu64| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGPN
FTSTAMKAACWWANVQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKISNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Casado, G Identification of a novel HIV-1 circulating ADG intersubtype recombinant form (CRF19_cpx) in Cuba. JAIDS, 2005