<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
YNRL9613 YNRL9613 China 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17C, D41E, L101I, T112V, T125A, V201I, T218I, I220V, D253E, A265V  
>YNRL9613| codons 1-288
FLDGIDKAQEEHEKYHCNWRAMASDFNLPPVVAKEIVASCEKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKVQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQENSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, K14R, I15V, L19I, M36V, R41K, L63P, I93L  
>YNRL9613| codons 1-99
PQITLWQRPLVSVRVGGQIKEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135V, S162C, F171L, P243S, V245Q, K277R, Q278E, E297K, P313S, Q334L, F346Y, P420S, V435E, D460N, R461K, S468T, T470N, L491V, A554S  
>YNRL9613| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPLRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGTKALTEVIPLTKEAE
LELAENREILKESVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPYKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTS
PLVKLWYQLEKEPIEGAETFYVDGAANRETKLGKAGYVTNKGRQKVVTLNDTTNQKTELQ
AIHLALQDSGVEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Qiu, Z Characterization of five nearly full-length genomes of early HIV type 1 strains in Ruili city: Implications for the genesis of CRF07_BC and CRF08_BC circulating in China. ARHR, 2005