<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
0989MO 01CM.0989 Cameroon 2001 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, S24N, V31I, M50I, L101I, T112V, S119P, T124A, T125A, G134N, K136T, V165I, V201I, T206S, D207E, T218S, S230N, L234I, D256E, A265V S283G
>01CM.0989| codons 1-288
FLDGIDKAQEEHERYHSNWRAMANDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGPN
FTSAAVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASEIQTKELQKQISKIQNFRVYYRDNRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKVKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, R41K, H69K, L89M E35S
>01CM.0989| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLESINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kijak, GH Development and application of a high-throughput HIV type 1 genotyping assay to identify CRF02_AG in West/West Central Africa. ARHR, 2004