<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1152NG 01CM.1152 Cameroon 2001 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, E35D, M36L, R41K, H69K, L89M  
>01CM.1152| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11A, V35T, T39K, D121Y, K122E, K173S, Q174K, D177E, Q207A, R211S, V245Q, T286A, E291D, I293V, E312D, G335D, M357K, G359S, K366R, E370D, I375V, T377L, T403M, E413D, E432D, V435M, V458I, D471E, T477A, Q480H, H483Q, Q487R, L491S, A502S, K512R, E514D, S519N, Q524K, K527E, A534S, V548I, A554S  
>01CM.1152| codons 1-560
PISPIETVPVALKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTDAVQKVALESIVIWGKTPKFKLPIQKETWEAWWMEYWQATWIPDWEFVNTP
PLVKLWYQLEKDPIMGAETFYVDGAANRETKLGKAGYITDRGRQKVVSLTETTNQKAELH
AIQLALRDSGSEVNIVTDSQYSLGIIQAQPDRSDSELVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQIDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, A21T, A23V, S24N, D25E, V31I, M50I, I72V, L101I, T112V, T124A, T125A, G134N, K136Q, V165I, D167E, V201I, T206S, D207E, T218I, I220V, L234I S283G
>01CM.1152| codons 1-288
FLDGIDKAQEDHERYHSNWRTMVNEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQIREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASEIQTKELQKQIIKVQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Kijak, GH Development and application of a high-throughput HIV type 1 genotyping assay to identify CRF02_AG in West/West Central Africa. ARHR, 2004