<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1296NG 01CM.1296 Cameroon 2001 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S24A, V31I, V37I, S39N, I72V, L101I, T112M, T124A, T125A, G134D, I135V, K136Q, V201I, T206S, L234I, D270H S283G
>01CM.1296| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMAADFNLPPIVAKEIIANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKMIHTDNGSN
FTSAAVKAACWWADVQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRHYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K20M, E35D, M36I, N37S, R41K, L63P, H69Q, I72L, L89I  
>01CM.1296| codons 1-99
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKALGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V21I, V35T, T39A, V60I, D121Y, K122E, I135T, S162N, Q174K, D177E, T200A, Q207N, R211K, I244V, V245K, A272S, K281R, L283I, E291D, V292I, I293V, E297A, G335D, R356K, G359S, K366R, T386I, A400T, E404D, P421H, K431T, L452Q, V466I, D471E, Q480H, H483Y, A502V, Q509K, L517I, S519N, Q524E, E529D, A534S G262E
>01CM.1296| codons 1-560
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVKLPEKDSWTVNDIQKLVEKLNWASQIYSGIKVKQLCRLIRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVRQLTEAVQKIATESIVIWGKIPKFKLPIQKETWETWWTDYWQATWIPEWEFVNTP
HLVKLWYQLETEPIVGAETFYVDGAANRETKQGKAGYVTDRGRQKIVSLTETTNQKTELH
AIYLALQDSGLEVNIVTDSQYVLGIIQAKPDKSESEIVNQIIEELIKKDKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Kijak, GH Development and application of a high-throughput HIV type 1 genotyping assay to identify CRF02_AG in West/West Central Africa. ARHR, 2004