<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
0190MA 01CM.0190 Cameroon 2001 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35G, M36I, R41K, H69K, V77L, L89M  
>01CM.0190| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLLGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39R, K104R, K122E, D123G, T139M, S162A, K173T, Q174K, D177E, V179I, T200A, Q207E, R211K, F214L, V245Q, E248N, T286A, E291D, V292I, I293V, P294T, E297D, S322A, L325I, R356K, M357K, G359S, T369A, E370D, A371V, K374R, I375V, A376T, K390R, A400T, T403M, E432D, V435I, S468P, D471E, Q480H, L491S, K512R, S519N, Q524K, K527E, E529D, A534S, A554N, K558R  
>01CM.0190| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTDEAE
LELAENREILKEPVHGVYYDPAKDIIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLADVVQRVTTESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRRVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L68I E11D, K14R, V31I, D41N, M50I, I72V, L101I, T112V, T124A, T125A, G134D, K136Q, D167E, V201I, T206S, T218I, L234I S283G, D288N
>01CM.0190| codons 1-288
FLDGIDKAQEDHERYHSNWRAMASDFNLPPIVAKEIVASCNKCQLKGEAIHGQVDCSPGI
WQLDCTHIEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWADIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDEN

References
Author Title Citation
Kijak, GH Development and application of a high-throughput HIV type 1 genotyping assay to identify CRF02_AG in West/West Central Africa. ARHR, 2004