<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
0925MO 01CM.0925 Cameroon 2001 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, A21T, V31I, I72V, L101I, T112V, T124A, T125A, G134N, I135V, K136T, V201I, T206S, L234I, A265V, R269K, D270H K186R
>01CM.0925| codons 1-288
FLDGIDKAQEDHEKYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFRRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKHYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, K20I, E35D, M36I, N37S, R41K, L63I, H69Q, L89M  
>01CM.0925| codons 1-99
PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVRQYD
QIIIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35T, E36D, K43R, V60I, S162A, K173I, Q174K, D177E, I178M, T200A, E204D, Q207E, R211K, F214L, V245Q, A272P, K275Q, K277R, T286A, E291D, V292I, I293V, P294T, S322A, Q334E, G335D, R356K, M357K, G359S, I375V, V381I, K390R, A400T, T403M, E432D, E449D, T470P, D471E, Q480H, L491S, K512R, L517I, S519N, Q524K, K527G, E529D, A534S, A554S K13R
>01CM.0925| codons 1-560
PISPIKTVPVKLRPGMDGPKVKQWPLTEEKIKALTDICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEDLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGEDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEAVQKVATESIIIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRDTKLGKAGYVTDRGRQKVVSLPETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Kijak, GH Development and application of a high-throughput HIV type 1 genotyping assay to identify CRF02_AG in West/West Central Africa. ARHR, 2004