<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2348SA 02CM.2348 Cameroon 2002 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, N37D, L38F, R41K, L63I, H69K, I72V, L89M  
>02CM.2348| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEIDFPGKWKPKMIGGIGGFIKVRQYD
QIIIEICGKKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, I135V, S162C, K173R, Q174K, D177E, I178M, T200E, E203Q, Q207E, V245K, V261I, T286A, V292I, I293V, P294T, S322A, I326V, G335D, R356K, M357K, G359S, K366R, A371V, I375V, K390R, T403M, E432D, V435I, T450N, S468T, D471E, Q480H, L491S, L503I, K512R, S519N, Q524K, K527E, E529D, A534S, A554N  
>02CM.2348| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPEMVI
YQYMDDLYVGSDLEIGQHREKIQELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLIGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLTEVVQKVATESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRENKLGKAGYVTDRGRQKVVTLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYAIGIIQAQPDRSESELVNQIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Kijak, GH Development and application of a high-throughput HIV type 1 genotyping assay to identify CRF02_AG in West/West Central Africa. ARHR, 2004