<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MP578 97CM.578 Cameroon 1997 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13AV, K14R, K20I, M36I, R41K, K43R, H69K, L89M  
>97CM.578| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K49R, K122E, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, R211RK, V245Q, K281R, T286A, E291D, V292I, I293V, P294T, S322A, I326V, G335D, R356K, M357R, R358K, G359S, A371V, I375V, I382T, K390R, T403L, E413D, V435A, V466A, D471E, Q480H, H483Y, L491S, K512R, S519N, Q524K, K527E, E529D, A534S, A554NS, V559VI  
>97CM.578| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRKSA
HTNDVKQLTEVVQKVATESIVTWGKTPKFRLPIQKETWEAWWLEYWQATWIPDWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKAVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L74M K14R, V31VI, L63I, L101I, T112V, T124A, G134N, I135V, K136T, V201I, T206S, L234I  
>97CM.578| codons 1-249
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQIDCTHLEGKIIMVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSATVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAV

References
Author Title Citation
Njai, HF The predominance of human immunodeficiency virus type 1 (HIV-1) circulating recombinant form 02 (CRF02_AG) in West Central Africa may be related to its replicative fitness. Retrovirology, 2006