<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MP581 97CM.581 Cameroon 1997 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, L101I, T112V, T124A, T125A, G134D, I135V, K136T, V201I, T206S, L234I  
>97CM.581| codons 1-249
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWADVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, G16E, K20I, M36I, R41K, I64M, H69K, K70R, L89M  
>97CM.581| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39S, K122E, D123S, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, T286A, E291D, I293V, P294T, S322A, I326V, G335D, R356K, M357K, R358K, G359S, K366R, A371V, I375V, K390R, T403Q, V467I, D471E, Q480QH, L491S, K512R, S519N, Q524K, K527E, E529D, A534S, A554N, V559I  
>97CM.581| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICSEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKKSA
HTNDVRQLTEVVQKVATESIVIWGKTPKFRLPIQKETWEAWWQEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVISLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKIL

References
Author Title Citation
Njai, HF The predominance of human immunodeficiency virus type 1 (HIV-1) circulating recombinant form 02 (CRF02_AG) in West Central Africa may be related to its replicative fitness. Retrovirology, 2006