<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MP1370 99CM.1370 Cameroon 1999 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, A21T, V31I, M50I, K71KN, L101I, T112V, T124A, G134N, D167E, V201I, T218I, L234I  
>99CM.1370| codons 1-249
FLDGIDKAQEDHEKYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGNIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSATVKAACWWANIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13V, I15V, E35D, M36I, N37D, R41K, D60E, I62V, H69K, L89M  
>99CM.1370| codons 1-99
PQITLWQRPLVAVKVGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, T39K, D123N, I142V, K173S, D177E, Q207A, R211K, V245Q, K275R, K277R, T286A, E291D, I293V, E312N, Q334S, G335D, R356K, M357K, R358K, G359S, A360T, T369V, Q373H, I375V, A376T, T403M, E413D, E432D, V435I, T470N, D471E, Q480H, H483Q, L491P, K512R, L517I, S519N, Q524K, K527E, A534S, A554S  
>99CM.1370| codons 1-560
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVRQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEIQKQGSDQWTYQIYQEPFKNLKTGKYAKKKST
HTNDVKQLVEAVHKVTTESIVIWGKTPKFKLPIQKETWEAWWMEYWQATWIPDWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLNETTNQKTELH
AIQLALQDSGPEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Njai, HF The predominance of human immunodeficiency virus type 1 (HIV-1) circulating recombinant form 02 (CRF02_AG) in West Central Africa may be related to its replicative fitness. Retrovirology, 2006