<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB118 CB118 Cuba 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, R20K, L101I, T112V, S119P, T122I, T124A, T125A, G134D, K136T, V201I, L234I, N254S, S255N, D256E S283G
>CB118| codons 1-288
FLDGIDKAQEEHERYHSNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGPN
FISAAVKAACWWADITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDSNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T   I13V, K14R, K20I, E35D, M36I, R41K, L63P, H69K, L89M  
>CB118| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPTNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y       K122E, D123E, S162C, D177E, I178L, T200A, R211K, A272P, I293V, E297A, Q334L, R358K, G359S, A360T, A371V, T377Q, K390R, T403M, R463K, L491S, A554S  
>CB118| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMKST
HTNDVKQLTEVVQKIAQESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGKQKVVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Sierra, M Identification of 3 phylogenetically related HIV-1 BG intersubtype circulating recombinant forms in Cuba. JAIDS, 2007