<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AF104 05AF104 Afghanistan 2005 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, K14R, V31I, S39N, I60M, I72V, T112I, I113V, T124A, T125A, V126F, K136H, D167E, V201I, I203M S283G
>05AF104| codons 1-288
FLDGIEKAQEEHERYHSNWRAMASDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGM
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKIVHTDNGSN
FTSAAFKAACWWAGIHQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19Q, K20R, E35D, M36I, R41K, R57K, H69K, K70R, L89M  
>05AF104| codons 1-99
PQITLWQRPLVTVKIGGQQREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, V60I, D121Y, K122E, D177E, V179I, T200I, Q207A, R211K, D250E, A272P, I274V, T286A, E291D, V292I, I293V, E297A, I309L, G335D, R356K, M357K, G359S, E370D, A371V, I375V, A376S, T377M, K390R, T403M, E404D, E432D, V435I, D471E, Q480H, L491S, K512N, L517V, S519N, Q524E, I526V, E529D, A534S, A554N, V559I K11G
>05AF104| codons 1-560
PISPIDTVPVGLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGVKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENRELLKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTDVVQKVSMESIVIWGKTPKFRLPIQKETWEAWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDNSESEVVNQIIEELVKKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKIL

References
Author Title Citation
Sanders-Buell, E A nascent HIV type 1 epidemic among injecting drug users in Kabul, Afghanistan is dominated by complex AD recombinant strain, CRF35_AD. ARHR, 2007