<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AF095 05AF095 Afghanistan 2005 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19Q, K20R, E35D, M36I, R41K, R57K, H69K, L89M, I93L  
>05AF095| codons 1-99
PQITLWQRPLVTVKIGGQQREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6N, K11R, V35T, V60I, K122E, I135T, D177E, G196S, T200I, Q207A, R211K, V245E, D250E, A272P, I274V, K277R, E291D, V292I, I293V, I309L, G335D, R356K, M357K, G359S, A371V, I375V, A376T, T377L, T386I, K390R, T403M, E404D, E432D, D471E, Q480H, L491S, S519N, Q524K, I526V, K527E, E529D, A534S, A554T  
>05AF095| codons 1-560
PISPINTVPVRLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEISQHRIKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGVKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENRELLKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVTLESIVIWGKIPKFRLPIQKETWEAWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEKLVEKDKVYLSWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
Sanders-Buell, E A nascent HIV type 1 epidemic among injecting drug users in Kabul, Afghanistan is dominated by complex AD recombinant strain, CRF35_AD. ARHR, 2007