<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+DDI 8
3 3TC+D4T+IDV 22
4 NFV+NVP+SQV 35
5 None 24
6 3TC+AZT+IDV+RTV 13
7 3TC+AZT+IDV+SQV 32
8 ABC+D4T+EFV+RTV+SQV 104
9 3TC+ABC+EFV+LPV+SQV 19
10 3TC+LPV+TDF 52
11 3TC+LPV+T20+TDF 126
12 DDI+APV+FTC+RTV+T20+TDF 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219R K103N, V106M   K20R, V35M, E44ED, K64KR, V111I, E169D, Q174QR, V179I, T200A, I202IV, H208Y, R211K, K223Q, L228Q  
>CA87356| codons 1-240
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEKDGKISKIGPENPYNTPV
FAIRKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDIGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKRNPDIII
YQYVDDLYVGSDLEIGQHRAKVEELRQYLWKWGFYTPDRKHQQEPPFQWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V V11VI, L24I, L33I, L89V L10I, I13V, Q18QH, K20R, E35D, M36I, N37D, R57K, L63P, A71V, I72IV, I93L  
>CA87357| codons 1-99
PQITLWQRPIITVKIGGHLREALIDTGADDTVIEDIDLPGRWKPKIIGGIGGFVKVKQYD
QIPIEICGHKVVGTVLVGPTPTNVIGRNVLTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012