<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 D4T+DDC+NVP+RTV+SQV 130
2 ABC+APV+NVP+RTV 209
3 ABC+ATV+NVP+RTV 135

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W A62V, V75I, K219N V106A F227L K20R, E44D, T69N, L109I, I142V, D177E, H208Y, R211K, D218E  
>CA87354| codons 1-240
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FVIKKKNSNKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVIDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFTTPENKHQKEPPLLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V   L10IV, K14R, I15V, M36I, D60E, I62V, I64V, T74A  
>CA87355| codons 1-99
PQITLWQRPIVTIRVGGQLKEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFVKVRQYE
QVLVEICGHKAIGAVLVGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012