<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 DDI 157
2 D4T 109
3 D4T+DDI+SQV 21
4 AZT+NFV+NVP 78
5 ABC+IDV+RTV 148
6 EFV+LPV+TDF 174
7 FTC+RTV+T20+TDF+TPV 83

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, I54V, V82VL, I84V, L90M V11I, G73T T4S, I13V, L19V, K20IV, L33V, E35D, M36I, N37NS, K55R, R57K, L63P, I64V, C67F, H69R, A71I, I72F, P79A, I93L, T96S  
>CA87353| codons 1-99
PQISLWQRPLITVKIGGQVIEALLDTGADDTVVEDISLPGRWKPKIIGGIGGFVRVKQYD
QIPVEIFGRKIFTTVLVGATPLNVIGRNLMTQLGCSLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y V75I, K219E Y181C, G190S   V35R, T69N, K101Q, I135T, Q174R, T200A, L210F, R211K, L228H  
>CA87352| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
CQYVDDLYVSSDLEIGQHRAKIEELRQHLFKWGFYTPDEKHQKEPPFHWMGYELHPDKWT

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010