<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 13
2 3TC+D4T+NFV 100
3 NVP+RTV+SQV 61
4 D4T+NVP+RTV+SQV 92
5 3TC+APV+D4T+LPV+TDF 178
6 3TC+APV+LPV+TDF 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54IV, L90M V11VI, F53FL, Q58QE, N83ND, N88D T12TA, I13IV, L19I, K20I, E35N, M36I, N37DE, D60E, Q61E, L63P, A71V, I72T  
>CA87351| codons 1-99
PQITLWQRPLIAVKIGGQIIEALLDTGADNTVLENIDLPGRWKPKMIGGIGGLVKVREYE
EIPIEICGHKVTGTVLVGPTPVDIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y K103N, Y181C   V35I, S68G, V90I, D121H, T139TA, K173Q, Q174R, D177E, I178L, G196E, T200A, R211RT, F214L  
>CA87350| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
HKDFRKYTAFTIPSINNEAPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRQRNPELVI
CQYMDDLYVGSDLEIEQHRAKIEELRQHLLTWGLTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010