<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 110
2 D4T+IDV+NVP 24
3 None 70
4 D4T+DDI+LPV 78
5 D4T+DDI+LPV+TDF 57
6 3TC+ABC+ATV+AZT+RTV 146

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D K20R, E35D, M36I, R41K, D60DE, L63P, A71AT, V77I, I93IL  
>CA87349| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGHKTIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y188YFHL   K20KR, D121H, R172RK, D177E, R211RK  
>CA87348| codons 1-240
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPEIVI
YQYMDDLFVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010