<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT+DDC 35
2 D4T 65
3 3TC+AZT 13
4 3TC+AZT+IDV 65
5 DDI+NFV+NVP 22
6 3TC+D4T+IDV 61
7 3TC+D4T+EFV+IDV 26
8 3TC+D4T+EFV+IDV+RTV 165
9 3TC+ABC+DDI+SQV+TDF 17
10 3TC+ABC+LPV+TDF 57
11 3TC+ATV+DDI+RTV+TDF 126

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184I K219Q Y181C, Y188L, G190A   P4S, V21F, V90I, D123Q, I135T, T139TK, S162Y, D177E, I178IM, V179I, T200A, R211K P1H
>CA87346| codons 1-240
HISSIETVPVKLKPGMDGPKFKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKQFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEMII
CQYIDDLLVASDLEIGQHRAKIEELRQHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50L, I54V, V82A, L90M L33F, K43T, G73T L10I, T12TK, K55R, I62V, L63P, A71V, I72L, V77I, I93L, C95F  
>CA87347| codons 1-99
PQITLWQRPIVKIKIGGQLKEALLDTGADDTVFEEMNLPGRWTPKIIGGLGGFVRVRQYD
QVPIEICGHKVLTTVLIGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012