<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 74
2 D4T+NFV+NVP 48
3 3TC+D4T+DDI+NVP 39
4 3TC+D4T+IDV+NVP+RTV 96
5 3TC+D4T+LPV+NVP 96
6 3TC+AZT+IDV 87
7 DLV+RTV+T20+TDF+TPV 81

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82T L24I L10I, K20R, E35D, N37DE, R57RK, Q61H, I62V, L63P, I64V, A71V, I72V, T74S, I93L  
>CA87343| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEDMDLPGRWKPKIIGGIGGFVKVKQYD
HVPVEICGHKVVGSVVVGPTPTNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV, T215F A62AV, V75VI, F116FY, Q151QL Y188L   K11KR, T39TA, K43KQ, S68SG, V118I, I135T, V179I, H208HY, R211RK, F214L, K223KQ, L228H  
>CA87342| codons 1-240
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICAELEQEGKISKIGPENPYNTPV
FVIKKKDGTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPLGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIGQHRTKIEELRQYLLKWGLFTPDKKHQQEPPFHWMGYELHPDKWT

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010