<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt01 Pop11-2005 U.K. 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT NA
2 3TC+AZT+NVP NA
3 D4T+DDI+NVP NA
4 LPV+SQV+TDF NA
5 LPV+TDF NA
6 ATV+LPV NA
7 FTC+TDF 86

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, Q18QK, K20I, M36I, R41K, C67E, H69K, V82I, L89M  
>Pop11-2005| codons 1-99
PQITLWQRPLVTVRIGGKLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, M184V       V35T, V60I, K122E, I135V, I142V, S162C, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K, V245Q, E248D, D250E, S251N, A272P, T286A, E291D, V292I, I293V, E297A, S322A, D324E, I329IV  
>Pop11-2005| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKENWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPAKELIAEVQKQG

References
Author Title Citation
Bradshaw, D Characterization of a novel drug-resistance pattern associated with the mutations K70G and M184V in HIV-1 reverse transcriptase. AAC, 2007