<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3984 54929R Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L89V L10I, K14R, I15V, Q18H, L19Q, K20I, M36I, L63P, A71T  
>54929R| codons 1-99
PQITLWQRPIVTIRVGGHQIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, L74V, L210W, T215Y K219N L100I, K103N, Y181C   V60I, S68G, K122E, I135T, I142V  
>54929R| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Vicenti, I Use of peripheral blood DNA for genotype antiretroviral resistance testing in drug-naive HIV-infected subjects. Clin Infect Dis, 2007