<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LR_97 35052R Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, M36L, N37ST, I62V, L63LP, H69Y, I72M  
>35052R| codons 1-99
PQITLWQRPLVTIKIGGQTKEALLDTGADDTVLEELTLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGYKAMGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K82R, I135T, I142T, F214L  
>35052R| codons 30-229
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNRRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGTRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHL
LRWGLTTPDKKHQKEPPFLW

References
Author Title Citation
Vicenti, I Use of peripheral blood DNA for genotype antiretroviral resistance testing in drug-naive HIV-infected subjects. Clin Infect Dis, 2007