<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3112 37086R Italy 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, M36I, R41K, K43R, H69K, K70R, L89M  
>37086R| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35L, E36D, V106I, K122KE, D123E, I135V, A158S, S162G, K173T, Q174K, D177E, I178IM, T200A, I202V, R211K, F214L, F227I  
>37086R| codons 30-229
KIKALLDICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSITVLDVGDAYFSVPLDEEFRKYTAFTIPSVNNETPGIRYQYNVL
PQGWKGSPSIFQGSMTKILEPFRTKNPEMVIYQYMDDLYVGSDLEIGQHRAKVEELRQHL
LKWGLTTPDKKHQKEPPILW

References
Author Title Citation
Vicenti, I Use of peripheral blood DNA for genotype antiretroviral resistance testing in drug-naive HIV-infected subjects. Clin Infect Dis, 2007