<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LR_102 36382 Italy 2000 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I N37S, R41K, D60E, Q61E, L63P, V77VI, I93L  
>36382| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGKWKPKMIGGIGGFIKVRQYE
EIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, I135V, D177E, I178V, R211K  
>36382| codons 30-229
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPEVVIYQYMDDLYVGSDLEIGQHRTKIEELRQHL
LKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Vicenti, I Use of peripheral blood DNA for genotype antiretroviral resistance testing in drug-naive HIV-infected subjects. Clin Infect Dis, 2007