<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
24 GHN24 Ghana 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14KR, I15IV, G16E, K20I, E35K, M36I, R41N, H69K, K70R, L89M  
>GHN24| codons 1-99
PQITLWQRPIVTVRVEGQLIEALLDTGADDTVLEKINLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, V60VI, D123E, I135V, S162A, K173KT, Q174N, D177E, T200A, Q207E, R211K, V245KT, E248D, D250DE, S251SC, A272P, T286A, V292I, I293V, P294T, S322T E29ED, F61FL
>GHN24| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEDKIKALTDICTEMEKEGKISKIGPENPYNTPI
LAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTNNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKECWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQ

References
Author Title Citation
Sagoe, KW Variability of the human immunodeficiency virus type 1 polymerase gene from treatment naive patients in Accra, Ghana. J Clin Virol, 2007