<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1646 1646_3858 Botswana 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+NNRTI 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, I15V, L19I, M36I, R41K, D60E, Q61E, L63PS, I64IL, H69K, L89M, I93L  
>1646_3858| codons 1-99
PQITLWQRPIVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
EISLEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D P4S, V35T, E36A, T39E, S48ST, K103KR, K122E, D123S, E138A, K173A, Q174K, T200A, I202V, Q207E, R211K, F214L, L228LH, V245E, A272P, K277R, A288T, E291D, V292I, I293V, H315F  
>1646_3858| codons 1-333
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIDI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKTLTDIVPLTEEAE
LELAENREILKEPVFGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Novitsky, V The reverse transcriptase 67N 70R 215Y genotype is the predominant TAM pathway associated with virologic failure among HIV type 1C-infected adults treated with ZDV/ddI-containing HAART in southern Africa. ARHR, 2007