<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1467 1467_1693 Botswana 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+NNRTI 31

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19I, M36I, R41K, L63S, H69K, L89M, I93L  
>1467_1693| codons 1-99
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K103N, Y181C   P4S, T27S, E28K, V35T, T39E, S48T, I50V, K122E, D123S, I142V, K173T, D177E, T200A, Q207E, R211K, H221HY, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, E297K  
>1467_1693| codons 1-333
PISSIETVPVKLKPGMDGPKVKQWPLSKEKIKALTEICEEMEKEGKITKVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Novitsky, V The reverse transcriptase 67N 70R 215Y genotype is the predominant TAM pathway associated with virologic failure among HIV type 1C-infected adults treated with ZDV/ddI-containing HAART in southern Africa. ARHR, 2007