<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1195 1195_2127 Botswana 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+NNRTI 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR   K101KE, G190A   K20KR, E28K, K32KE, V35T, E36A, T39E, K102KR, K122E, D123DN, K173A, Q174K, D177E, T200A, I202IV, Q207E, R211K, D237DN, V245EQ, D250E, A272P, K277R, E291D, V292I, I293V  
>1195_2127| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIEALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVASDLEIGQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPNKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, N37S, R41K, L63P, H69K, V77I, L89M, I93L  
>1195_2127| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Novitsky, V The reverse transcriptase 67N 70R 215Y genotype is the predominant TAM pathway associated with virologic failure among HIV type 1C-infected adults treated with ZDV/ddI-containing HAART in southern Africa. ARHR, 2007