<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1072 1072_2326 Botswana 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+NNRTI 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y181YC, G190GA   V35T, E36A, T39E, S48T, K122E, K173A, D177E, Q207E, R211K, L228LR, V245Q, E248D, D250DE, A272P, K277R, T286A, E291D, V292I  
>1072_2326| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
CQYMDDLYVASDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, H69K, L89LM, I93L  
>1072_2326| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Novitsky, V The reverse transcriptase 67N 70R 215Y genotype is the predominant TAM pathway associated with virologic failure among HIV type 1C-infected adults treated with ZDV/ddI-containing HAART in southern Africa. ARHR, 2007