<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 DDI 70
2 3TC+AZT+IDV 105
3 3TC+D4T+IDV 118
4 APV+D4T+EFV 38
5 ABC+EFV+LPV 26
6 3TC+AZT+IDV 74
7 3TC+LPV+T20+TDF 175

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82F, L90M   L10I, I13V, I15IV, L19Q, K20I, E35D, M36I, R57RK, I62V, I64V, A71V, I72V, I93F  
>5617_0409| codons 1-99
PQITLWQRPIVTVKVGGQQIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFVKVKQYD
QVLVEICGHKVVGTVVVGPTPFNIIGRNLMTQFGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       E6K, K20KR, K43S, V118I, K122E, I135IV, V179VI, T200A, E203D, R211K, L228H  
>5617_0409| codons 1-240
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELESEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIDELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010