<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PS2019 2019_d367 Australia 2005 HIV1 B PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, C56S, L101I, K111N, S119P, V201I, T206S, T218TS, D256E Q214QH
>2019_d367| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDSSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVNTIHTDNGPN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELHKQISKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, L63P, I66IV, K70KE, I93IL  
>2019_d367| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEVCGHEAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R211K, F214L, V245M, T286A, E291D, S322T, I329L, R356K, M357T, A376T, E399D, A400T, L452IV, L469I, L491P, A502S, V531I  
>2019_d367| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVIPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYAKTRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKVGKAGYVTDRGRQKVVSITDTTNQKTELQ
AIHLALQDSGPEVNIVTDSQYSLGIIQAQPDKSESELVSQIIEQLIKKEKIYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Li, B Rapid reversion of sequence polymorphisms dominates early human immunodeficiency virus type 1 evolution. J Virol, 2007