<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PS2008 2008_d377 Australia 2005 HIV1 B PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, L28I, P30A, S39C, M50I, L101I, T124A, V201I, T206S, T218S, D253E, M275V  
>2008_d377| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNIPAVVAKEIVACCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQISKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQENSDIKVVPRRKAKIIRDYGKQVAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13IV, K14R, I15V, E35EK, N37D, D60E, L63T, C67Y  
>2008_d377| codons 1-99
PQITLWQRPIVTVRVGGQLKEALLDTGADDTVLEKMDLPGRWKPKMIGGIGGFIKVRQYE
QITIEIYGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, S68G, D123E, I135T, R211K, A272P, T286A, Q334H, A360V, T369A, K374R, I375V, K390R, A400T, T403V, E404D, Q480H, L491S, S519N, K527N, V531I  
>2008_d377| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARMRGV
HTNDVKQLAEAVQRVATESIVIWGKTPKFRLPIQKETWETWWVDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLINKEKIYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Li, B Rapid reversion of sequence polymorphisms dominates early human immunodeficiency virus type 1 evolution. J Virol, 2007