<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PS1044 1044_d0 Australia 2004 HIV1 A PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, A21T, V31I, V32I, S39C, I72V, T112V, I113V, T124A, T125A, G134N, K136Q, D167E, V201I, Q216H, L234I, S255T S283G
>1044_d0| codons 1-288
FLDGIDKAQEDHERYHSNWRTMASDFNLPPIIAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKHITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNTDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   L10I, I13V, K14R, G16E, K20R, E35D, M36I, N37D, R41K, K45R, R57K, L63S, H69K, K70R, L89M  
>1044_d0| codons 1-99
PQITLWQRPIVTVRIEGQLREALLDTGADDTVLEDIDLPGKWKPRMIGGIGGFIKVKQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28A, V35T, E40D, V60I, K122E, D123N, I135T, F171Y, K173A, Q174K, V179I, T200A, Q207A, R211S, V245N, D250E, T286A, E291D, I293V, P294T, D324E, G335D, M357K, G359S, K366R, T369A, A371V, I375V, A376V, T377M, E399D, A400T, T403M, E404D, E432D, V467I, D471E, Q480H, H483Y, L491S, K512R, S519N, Q524K, K527G, E529D, A534S, A554S, K558R H361HY
>1044_d0| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRAKNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
YTNDVRQLAEVVQKVVMESIVIWGKTPKFKLPIQKETWDTWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVISLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRRVL

References
Author Title Citation
Li, B Rapid reversion of sequence polymorphisms dominates early human immunodeficiency virus type 1 evolution. J Virol, 2007