<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01UYTRA1020 01U_1020 Uruguay 2001 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, E35D, M36I, R41K, R57K, Q61N, C67D  
>01U_1020| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEIDGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S105A, D123E, I135V, I142V, P176Q, I178M, E194K, Q197E, A272P, T286P, V292I, I293V, E297R, G333E, K385R, K390R, Q394L, E399D, A400T, K431T, V435T, G436S, A446S, L452K, V466A, D471E, T477A, Q480H, H483Q, L491S, L517I, S519N, A534S K366E
>01U_1020| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKAVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNQDMVI
YQYMDDLYVGSDLKIGEHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGPKALTEIVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVEQLTEAVQKIATESIVIWGRTPKFRLPILKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPITSAETFYVDGASNRETKKGKAGYVTDRGRQKAVSLTETTNQKAELH
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, E11D, S17N, L45I, I84L, L101I, S119P, T124A, T125A, K136Q, V201I, A205S, T218I, L234V, D256E  
>01U_1020| codons 1-288
FLDGIEKAQEDHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQIKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTKELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Vinoles, J Seroincidence and phylogeny of human immunodeficiency virus infections in a cohort of commercial sex workers in Montevideo, Uruguay. Am J Trop Med Hyg, 2005