<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99TCDMN011 99TCDMN011 Chad 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6S, K7Q, E10D, E13D, L45I, K71Q, I113V, S119R, T124A, G163E, V201I, K211R, L234I, D253E, D279G  
>99TCDMN011| codons 1-288
FLDGISQAQDEHDKYHSNWRAMASDFNLPPVVAKEIVASCDKCQIKGEAMHGQVDCSPGI
WQLDCTHLEGQIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGRN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIEQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTRELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQENSDIKVVPRRKAKIIRDYGKQMAGDGCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19Q, E35D, M36I, R41K, D60E, L63P, I64V, K70T, I72V  
>99TCDMN011| codons 1-99
PQITLWQRPLVTIKVGGQQKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
QIPVEICGHTAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, V111I, K122A, I142T, S162C, E169D, D177E, I178L, T200A, E204K, Q207E, R211K, F214L, V245T, D250E, A272P, K281R, T286A, A288T, I293V, E297K, K311R, I329V, Y339W, M357I, R358K, A376S, T377L, K390R, T403M, V435M, S468P, L469F, H483N, L491S, L517I, A554S  
>99TCDMN011| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DADFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKTLTEVVPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEVQKQGQGQWTWQIYQEPFKNLKTGKYARIKGA
HTNDVKQLTEAVQKISLESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIMGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPFTDTTNQKTELQ
AINLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Vidal, N High genetic diversity of HIV-1 strains in Chad, West Central Africa. JAIDS, 2003