<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
92RW009_06 92RW009_06 Rwanda 1992 HIV1 C PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, R41K, R57K, H69K, L89M P81S
>92RW009_06| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTSVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11A, V35R, K122E, D123S, S162N, K173A, P176Q, D177E, T200A, Q207E, R211K, V245Q, A272P, I274V, K277R, E291D, V292I, I293V, Q334H, G335D, R356K, M357R, G359T, T377M, K390R, A400T, E404D, V435L, L452I, V466I, D471E, H483Q, L491S, K512S, L517A, S519N, K530R, A534S, A554S, K558R  
>92RW009_06| codons 1-560
PISPIETVPVALKPGMDGPKVKQWPLTEEKIKALREICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRAQNQEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGVKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPILGAETFYVDGAANRETKIGKAGYVTDRGRQKIVSLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDSSESEAVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRRVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I K14R, V31I, V79A, L101I, T112V, T124N, K136Q, K173R, V201I, L234I S283G
>92RW009_06| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHAASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNTVKAACWWAGIQQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLRTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Gao, F A comprehensive panel of near-full-length clones and reference sequences for non-subtype B isolates of human immunodeficiency virus type 1. J Virol, 1998