<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A0116 98UA0116 Ukraine 1998 HIV1 A Plasma Unknown

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, N37D, R41K, H69K, L89I, I93L  
>98UA0116| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, T39M, K122E, D123S, R125G, I142V, A158S, K173S, Q174K, D177E, E203G, Q207A, R211S, E233G, V245M, E248D, A272P, K277R, T286A, E291D, V292I, I293V, P294T, I326V, G335D, R356K, M357K, R358G, G359S, E370A, A371V, I375V, S379G, V381I, K390R, T403M, V417I, L452T, S468P, D471E, Q480H, L491S, K512R, L517I, S519N, Q520K, Q524K, K527E, K530R, A534S, A554Y, K558R Y232H
>98UA0116| codons 1-560
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFGKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIGELRAHLLSWGFTTPDKKHQKEPPFLWMGHGLHPDKWT
VQPIMLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKGSA
HTNDVKQLTAVVQKVATEGIIIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFINTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKTGKAGYVTDRGRQKVVPLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEIVNKIIEKLIEKERVYLSWVPAHK
GIGGNEQVDKLVSYGIRRVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D3E, R20K, V31I, I72V, L74I, T112V, I113V, S119P, T124S, T125A, G134N, K136Q, D167E, V201I, T218I, L234I, S255N  
>98UA0116| codons 1-288
FLEGIDKAQEEHEKYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGPN
FTSSAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Masharsky, AE Molecular cloning and analysis of full-length genome of HIV type 1 strains prevalent in countries of the former Soviet Union. ARHR, 2003