<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Fj063 Fj063 China 2004 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39K, K43E, K122E, D123S, I135L, R172K, K173I, Q174K, D177E, G196E, T200A, Q207A, L210F, R211S, V245E, K263R, A272T, E291D, V292I, I293V, E312T, I329V, G335D, M357K, G359S, K366R, A371V, S379G, K390R, K395R, A400T, E432D, N447S, D460N, D471E, Q480H, H483Y, L491S, K512R, L517I, S519N, Q524E, A534S, V548I, A554S H96R
>Fj063| codons 1-560
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPRPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKIKNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELRAHLFSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGRLNWASQIYTGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIATEGIVIWGKTPKFRLPIQRETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAASRETKLGKAGYVTNRGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQIDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, M36I, R41K, I62V, H69K, L89M  
>Fj063| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Hai-Long, H Genetic characterization of CRF01_AE full-length human immunodeficiency virus type 1 sequences from Fujian, China. ARHR, 2007